PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_022886-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 503aa    MW: 56541.3 Da    PI: 7.2494
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_022886-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.4e-144589348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT++Ed++l + ++++G+++W+ Ia+++   +t  qc+ rw++yl
    NNU_022886-RA 45 TWTQQEDDILREQINLHGTENWAIIASKFK-DKTTRQCRRRWYTYL 89
                     6****************************9.*************97 PP

2Myb_DNA-binding41.82.5e-1395138146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd +l +a k +G++ W+ I++ +  gRt++ +k+r+ +
    NNU_022886-RA  95 KGGWSPEEDMILCEAQKIFGNR-WTEISKVVS-GRTDNAVKNRFST 138
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.9853893IPR017930Myb domain
SMARTSM007171.6E-134291IPR001005SANT/Myb domain
SuperFamilySSF466893.59E-2542136IPR009057Homeodomain-like
CDDcd001675.96E-134589No hitNo description
Gene3DG3DSA:1.10.10.601.1E-194697IPR009057Homeodomain-like
PfamPF139213.0E-1446104No hitNo description
SMARTSM007173.9E-1494142IPR001005SANT/Myb domain
PROSITE profilePS5129416.33794144IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-1898143IPR009057Homeodomain-like
CDDcd001673.42E-1098139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MRLDPHKREP EEHINTEQQT MPSMNLQETP KSETTTKQKE RHIVTWTQQE DDILREQINL  60
HGTENWAIIA SKFKDKTTRQ CRRRWYTYLN SECKKGGWSP EEDMILCEAQ KIFGNRWTEI  120
SKVVSGRTDN AVKNRFSTLC KKRAKHEALS KENNASYINP NNKRIIFQDG LDLGNESADS  180
TAPCKKLRTY ISDLSENSTT KRGLTKECGV TKLQQIRPPF AVLVQNFHNV DNLPPKQHVS  240
NKNQEPCKYE VVGNNKAQGT FLRRDDPKIT ALKQQAELLS SLALKVNTEN TNQSLENAWK  300
ELQDFLNQTK EGDLNPQKIS EMDFLLEDFK DLLEDLKSSN LGSAPSMRQP DFSESPGSSE  360
YSTGSTVQSH AKGDKTEQPQ TEICSPDQYG GVGPMPIHKE IQNSGRGCED GTCSSITQGK  420
FLSCNELKDN DGVVFTLAHS EFSSPLQVTP LFQSLAAGIP SPKFSESERN FLLKTLGIGS  480
PSPNPSTNPS QPPPCRRALL HSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-274614410108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010242410.10.0PREDICTED: myb-like protein Q isoform X2
TrEMBLD7TNB90.0D7TNB9_VITVI; Putative uncharacterized protein
STRINGVIT_01s0026g01910.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.21e-149MYB family protein